Germany
Japan
United Kingdom
China
USD 447.00
In Stock
ASCL3 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
USD 564.00
3 Days
Carrier-free (BSA/glycerol-free) ASCL3 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
ASCL3 mouse monoclonal antibody,clone OTI1C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
ASCL3 mouse monoclonal antibody,clone OTI1C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 200.00
In Stock
ASCL3 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Anti-Ascl3 (mouse) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HLPEDYLEKRLSK, from the internal region of the protein sequence according to NP_064435.1. |
Rabbit Polyclonal Anti-Ascl3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ascl3 antibody: synthetic peptide directed towards the middle region of mouse Ascl3. Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR |
Rabbit Polyclonal Anti-ASCL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL3 antibody: synthetic peptide directed towards the C terminal of human ASCL3. Synthetic peptide located within the following region: PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT |
Active filters
Target Symbol
- ACHAETE SCUTE HOMOLOG 3