Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal TIRAP Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TIRAP antibody was raised against a peptide corresponding to amino acids near the middle of human TIRAP. |
Goat Polyclonal Antibody against TIRAP (C-terminal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EGEGERDSATVSDL, from the C Terminus of the protein sequence according to NP_683708.1. |
Goat Polyclonal Antibody against TIRAP (Internal Region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QTLLKKPKKRPNSPE, from the internal region of the protein sequence according to NP_001034750.1; NP_683708.1. |
Mouse Monoclonal Tirap Antibody (20D1055.1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TIRAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TIRAP antibody: synthetic peptide directed towards the middle region of human TIRAP. Synthetic peptide located within the following region: LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW |
Active filters
Target Symbol
- TIRAP