OSMR goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_003990.1. |
OSMR goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_003990.1. |
Anti-OSMR Reference Antibody (vixarelimab)
Applications | Animal Model, ELISA, FACS, FN, Kinetics |
Reactivities | Human, Cynomolgus |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-OSMR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OSMR antibody: synthetic peptide directed towards the N terminal of human OSMR. Synthetic peptide located within the following region: YQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ |
Rabbit Polyclonal Anti-OSMR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OSMR antibody: synthetic peptide directed towards the middle region of human OSMR. Synthetic peptide located within the following region: LLEKKTGYSQELAPSDNPHVLVDTLTSHSFTLSWKDYSTESQPGFIQGYH |
OSMR Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-330 of human OSMR (NP_003990.1). |
Modifications | Unmodified |