Rabbit Polyclonal Anti-HSPA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPA4 |
Rabbit Polyclonal Anti-HSPA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPA4 |
HSPA4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPA4 |
HSPA4 mouse monoclonal antibody, clone 5A6, Ascites
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-Hsp70 Antibody
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4. Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK |
Rabbit Polyclonal Anti-HSPA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4. Synthetic peptide located within the following region: PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS |