Primary Antibodies

Jump to Filters
View as table Download
PDE6 alpha (PDE6A) Rabbit Polyclonal Antibody
TA317150

USD 515.00

5 Days

Phosphodiesterase 6a / PDE6A Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Mouse, Rat, Gibbon, Hamster (Predicted: Dog, Rabbit)
Conjugation Unconjugated
Immunogen PDE6A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE6A / PDE6 Alpha. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Dog, Panda, Rabbit (94%); Bovine, Bat, Elephant (89%); Horse, Opossum (83%).
PDE6 alpha (PDE6A) Rabbit Polyclonal Antibody
TA335152

USD 539.00

5 Days

Rabbit polyclonal Anti-PDE6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE6A antibody is: synthetic peptide directed towards the N-terminal region of Human PDE6A. Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK
PDE6 alpha (PDE6A) Rabbit Polyclonal Antibody
TA360173

USD 539.00

5 Days

PDE6A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PDE6A