C1QA mouse monoclonal antibody, clone JL-1, Biotin
Applications | ELISA, FN, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
C1QA mouse monoclonal antibody, clone JL-1, Biotin
Applications | ELISA, FN, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
C1QA Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli. |
C1QA mouse monoclonal antibody,clone OTI6G5
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1QA mouse monoclonal antibody,clone OTI2B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
C1QA mouse monoclonal antibody,clone OTI2E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free)C1QA mouse monoclonal antibody,clone OTI6G5
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free)C1QA mouse monoclonal antibody,clone OTI2B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free)C1QA mouse monoclonal antibody,clone OTI2E7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-C1QA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG |
C1QA mouse monoclonal antibody, clone JL-1, Purified
Applications | ELISA, FN, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
C1QA mouse monoclonal antibody, clone JL-1, FITC
Applications | ELISA, FN, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | FITC |
C1QA mouse monoclonal antibody, clone 242G3, Purified
Applications | ELISA, FN, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C1QA mouse monoclonal antibody, clone 3R9/2, Purified
Applications | ELISA, FC, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
C1QA mouse monoclonal antibody,clone OTI6G5
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
C1QA mouse monoclonal antibody,clone OTI2B2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |