Cytokeratin 3 (KRT3) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of Human keratin K3 (formerly also designated cytokeratin 3; C- IKF SQS SQS SQR YSR), coupled to KLH |
Cytokeratin 3 (KRT3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 413-441 amino acids from the Central region of human KRT3 |
Rabbit Polyclonal Anti-KRT3 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT3 antibody: synthetic peptide directed towards the C terminal of human KRT3. Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR |
Cytokeratin 3 (KRT3) mouse monoclonal antibody, clone AE5, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Rabbit |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China