Primary Antibodies

View as table Download

Goat Polyclonal Antibody against PERP

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence CLPNYEDDLLGNAK, from the C Terminus of the protein sequence according to NP_071404.2.

Rabbit Polyclonal Anti-PERP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP. Synthetic peptide located within the following region: FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG