Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to LBP (lipopolysaccharide binding protein)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 166 and 467 of LBP (Uniprot ID#P18428)

Rabbit Polyclonal Anti-LBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LBP antibody: synthetic peptide directed towards the middle region of human LBP. Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV

Rabbit Polyclonal Anti-LBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LBP antibody: synthetic peptide directed towards the C terminal of human LBP. Synthetic peptide located within the following region: FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL

LBP mouse monoclonal antibody, clone 1C7, Purified

Applications ELISA, FN, IP
Reactivities Human
Conjugation Unconjugated

LBP mouse monoclonal antibody, clone 6G3, Purified

Applications ELISA, FN, IP
Reactivities Bovine, Canine, Goat, Human, Monkey, Porcine, Rabbit, Rat, Sheep
Conjugation Unconjugated