Rabbit Polyclonal Anti-CLDN11 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLDN11 |
Rabbit Polyclonal Anti-CLDN11 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CLDN11 |
Rabbit Polyclonal Anti-CLDN11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
Rabbit polyclonal Claudin 11 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 11. |
USD 575.00
2 Weeks
Oligodendrocyte Specific Protein (CLDN11) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from C-terminal of human claudin 11 protein |
Rabbit anti-CLDN11 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CLDN11 |
Rabbit Polyclonal Anti-Claudin 11 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit Polyclonal Anti-Claudin 11 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Cow |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 11 Antibody: A synthesized peptide derived from human Claudin 11 |
Rabbit anti Claudin 11 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |