NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal NEU2 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NEU2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-50 amino acids from the N-terminal region of human NEU2. |
NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
NEU2 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
NEU2 mouse monoclonal antibody, clone OTI8C12 (formerly 8C12), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal Neuraminidase antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-124 of Human Neu2. |
NEU2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH |