Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Drosophila, Feline, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
Conjugation | Unconjugated |
Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
Applications | ICC/IF, IHC, Immunoblotting, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
Conjugation | Unconjugated |
Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
FH (176-189) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human FH |
Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody
Applications | Dot, WB |
Reactivities | Human, Chicken, Drosophila, Yeast |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928] |
USD 550.00
5 Days
Mouse Monoclonal DNA Polymerase epsilon Antibody (3C5.1)
Applications | IHC, IP, WB |
Reactivities | Drosophila, Human, Mouse, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TPI1 Antibody
Applications | WB |
Reactivities | Human, Drosophila |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID |
Rabbit anti TK1 (Thymidine Kinase) Polyclonal Antibody
Applications | WB |
Reactivities | Drosophila |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of fruit fly thymidine kinase protein. |
POLR2A (794-822) mouse monoclonal antibody, clone ARNA-3, Supernatant
Applications | IF, IHC, WB |
Reactivities | Drosophila, Human |
Conjugation | Unconjugated |