Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NCF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NCF2

Rabbit anti-NCF2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NCF2

Rabbit Polyclonal Anti-NCF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCF2 antibody is: synthetic peptide directed towards the C-terminal region of Human NCF2. Synthetic peptide located within the following region: TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF

NCF2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NCF2