RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
Rabbit polyclonal anti-RAD51L1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD51L1. |
RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rad51L1 (RAD51B) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 201-250 of Human Rad51B. |
Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI |
Mouse Monoclonal Rad51L1 Antibody (1 H3/13)
Applications | ICC/IF, WB |
Reactivities | Human, Primate (Does not react with: Mouse) |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW |
RAD51B Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1 |