ENOPH1 mouse monoclonal antibody,clone OTI6B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ENOPH1 mouse monoclonal antibody,clone OTI6B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ENOPH1 mouse monoclonal antibody,clone OTI4E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ENOPH1 mouse monoclonal antibody,clone OTI4A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI6B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI4E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI4A8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI6B6, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI6B6, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4E1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4E1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4A8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ENOPH1 mouse monoclonal antibody,clone OTI4A8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-ENOPH1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the middle region of human ENOPH1. Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS |
Rabbit Polyclonal Anti-ENOPH1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the N terminal of human ENOPH1. Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD |
ENOPH1 mouse monoclonal antibody,clone OTI6B6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |