PLAT mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLAT mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLAT mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLAT mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
PLAT mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PLAT mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PLAT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Rabbit Polyclonal Anti-PLAT Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLAT antibody: synthetic peptide directed towards the middle region of human PLAT. Synthetic peptide located within the following region: TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR |
PLAT (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human TPA |
Rabbit anti-PLAT Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLAT |