Primary Antibodies

View as table Download

C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

C1R mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

C1R mouse monoclonal antibody, clone OTI1F1 (formerly 1F1)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R heavy chain.

Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human C1R.

C1R goat polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Conjugation Unconjugated
Immunogen The subunit C1r is isolated as a homogenous protein for use in antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization.

Rabbit Polyclonal Anti-C1R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1R antibody is: synthetic peptide directed towards the middle region of Human C1R. Synthetic peptide located within the following region: VDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDRHSCQ