Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
Rabbit Polyclonal Anti-C1galt1c1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1galt1c1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat C1galt1c1. Synthetic peptide located within the following region: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT |
Germany
Japan
United Kingdom
China