HAO1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HAO1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HAO1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HAO1 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HAO1 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HAO1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), Biotinylated
Applications | FC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
HAO1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HAO1 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HAO1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human HAO1 |
HAO1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HAO1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV |
HAO1 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HAO1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
Applications | FC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |