Primary Antibodies

View as table Download

HAO1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), HRP conjugated

Applications FC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation HRP

HAO1 mouse monoclonal antibody, clone OTI5F4 (formerly 5F4)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HAO1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human HAO1

HAO1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HAO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAO1 antibody: synthetic peptide directed towards the C terminal of human HAO1. Synthetic peptide located within the following region: GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV

HAO1 mouse monoclonal antibody, clone OTI3E7 (formerly 3E7)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HAO1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)

Applications FC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

HAO1 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated