Primary Antibodies

View as table Download

HGF mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HGF mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HGF mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

HGF mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

HGF mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin

HGF mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP

HGF mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HGF

Rabbit Polyclonal Anti-HGF Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG

Rabbit Polyclonal Anti-HGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the middle region of human HGF. Synthetic peptide located within the following region: NENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI

HGF mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-HGF Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HGF