Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal anti-ELOVL5 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL5. |
PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HADHA mouse monoclonal antibody,clone OTI7B3
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
HADHA mouse monoclonal antibody,clone OTI7B3, Biotinylated
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Biotin |
HADHA mouse monoclonal antibody,clone OTI7B3, HRP conjugated
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ACAA1 mouse monoclonal antibody,clone OTI4F1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ELOVL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
Anti-ACOT2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2 |
FADS2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of Human FADS2 |
Rabbit Polyclonal Anti-BAAT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BAAT |