Primary Antibodies

View as table Download

H4C1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human H4C1

H4C1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human H4C1

H4C1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human H4C1

Histone H4 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Histone H4. AA range:6-55

Acetyl-Histone H4 (Lys16) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic Peptide of Histone H4 (Acetyl Lys16) (Acetylated)

HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum

Applications ChIP, ELISA, IF, IP, WB
Reactivities Amphibian, Drosophila, Mammalian, Plant, Yeast
Conjugation Unconjugated
Immunogen Ovalbumin-conjugated peptide.

Phospho-Histone H4 (Ser1) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S1 of human Histone H4.Email for sequence (Phosphorylated)

Rabbit monoclonal to Acetylated Histone H4 Lysine 8 (K8ac)

Applications ChIP, ELISA, ICC, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated

Rabbit monoclonal to Acetylated Histone H4 Lysine 20 (K20ac)

Applications ChIP, ELISA, ICC, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated

Rabbit monoclonal to Acetylated Histone H4 Lysine 12 (K12ac)

Applications ChIP, ELISA, ICC, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated

Rabbit Polyclonal Anti-HIST1H4A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIST1H4A antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H4A. Synthetic peptide located within the following region: LGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK

Rabbit monoclonal to Phospho-Histone H4 (Ser1), H4S1p

Applications ELISA, ICC, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated

Rabbit monoclonal to Monomethylated Histone H4 Arginine 3, H4R3me1

Applications ELISA, ICC, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated

Rabbit monoclonal to Acetylated Histone H4 Lysine 5 (K5ac)

Applications ELISA, ICC, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated

Rabbit monoclonal to Acetylated Histone H4 Lysine 16 (K16ac)

Applications ELISA, LMNX, WB
Reactivities Human, Vertebrates
Conjugation Unconjugated