Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CAB39L Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAB39L

CAB39L rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CAB39L

Rabbit Polyclonal Anti-CAB39L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAB39L antibody: synthetic peptide directed towards the N terminal of human CAB39L. Synthetic peptide located within the following region: EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI