Primary Antibodies

Jump to Filters
View as table Download
ANKRD32 (SLF1) Rabbit Polyclonal Antibody
TA342942

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANKRD32 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANKRD32 antibody: synthetic peptide directed towards the N terminal of human ANKRD32. Synthetic peptide located within the following region: TNSVWTEHSNEETNKDFRKDAGFLEMKGALRETMYRTQKEMQNHEDVNVG
ANKRD32 (SLF1) (78-91) Rabbit Polyclonal Antibody
AP09252PU-N

USD 765.00

3 Days

ANKRD32 (SLF1) (78-91) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Chimpanzee, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 78-91 of Human Hallen