Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Egr1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV

Rabbit Polyclonal Anti-EGR1 Antibody

Applications IHC, WB
Reactivities Mouse, Xenopus
Conjugation Unconjugated
Immunogen The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of mouse EGR1. Synthetic peptide located within the following region: GTPEGSGGNSSSSTSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESF