Primary Antibodies

View as table Download

ADH7 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-386 of human ADH7 (NP_000664.2).
Modifications Unmodified

Rabbit Polyclonal Anti-Adh7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL