Anti-HMGA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
Anti-HMGA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
HMGA1 Rabbit monoclonal Antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal HMGA1 Antibody (C-term)
Applications | FC, IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
Conjugation | Unconjugated |
Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Goat Anti-HMGA1 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LASKQEKDGTEK, from the internal region of the protein sequence according to NP_665906.1; NP_665908.1; NP_002122.1; NP_665909.1; NP_665912.1; NP_665910.1. |
Anti-HMGA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
Goat Anti-HMGA1 (aa9-21) Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SQPLASKQEKDGT, from the internal region (near N Terminus) of the protein sequence according to NP_665906.1; NP_002122.1. |
HMGA1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1). |
Modifications | Unmodified |
Rabbit Polyclonal Anti-HMGA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HMGA1 Antibody: synthetic peptide directed towards the N terminal of human HMGA1. Synthetic peptide located within the following region: MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRP |