MLST8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLST8 |
MLST8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLST8 |
Rabbit Polyclonal Anti-GBL Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GBL antibody: synthetic peptide directed towards the middle region of human GBL. Synthetic peptide located within the following region: CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL |