Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EIF4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the C terminal of human EIF4B. Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ

Rabbit Polyclonal Anti-EIF4B Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV

Rabbit Polyclonal Anti-EIF4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the middle region of human EIF4B. Synthetic peptide located within the following region: QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS

Rabbit Polyclonal Anti-eIF4B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-eIF4B Antibody: A synthesized peptide derived from human eIF4B

Rabbit Polyclonal Anti-eIF4B (Phospho-Ser422) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-eIF4B (Phospho-Ser422) Antibody: A synthesized peptide derived from human eIF4B (Phospho-Ser422)
Modifications Phospho-specific