Rabbit Polyclonal Anti-ATG4D Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG4D |
Rabbit Polyclonal Anti-ATG4D Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATG4D |
Rabbit Polyclonal Anti-ATG4D Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATG4D antibody: synthetic peptide directed towards the middle region of human ATG4D. Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP |
Rabbit polyclonal anti-ATG4D antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ATG4D. |