Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH |
Rabbit polyclonal Collagen II antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen II. |
Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
BCL2 Rabbit monoclonal antibody,clone OTIR1C12
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
BCL2 Rabbit monoclonal antibody,clone OTIR1H2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
BCL2 Rabbit monoclonal antibody,clone OTIR3F2
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Anti-beta-Catenin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli. |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Goat Polyclonal Anti-CAV1 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human CAV1 produced in E. coli. |
Rabbit Polyclonal PAK2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2. |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
Modifications | Phospho-specific |