Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-EMR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen EMR1 / F4/80 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human EMR1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Marmoset (89%); Gibbon (83%).

Rabbit polyclonal anti-EMR1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EMR1.

Rabbit Polyclonal Anti-EMR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EMR1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMR1. Synthetic peptide located within the following region: GAFIFLIHCLLNGQVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG