Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit polyclonal AOC3 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |
Rabbit Polyclonal Anti-LYCAT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Goat Polyclonal Antibody against MAOB
Applications | FC, IF, IHC, PEP-ELISA, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3. |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Goat Anti-AOC3 Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1. |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan, Guinea Pig (Predicted: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Rabbit Polyclonal Anti-MAOB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA |
AOC2 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide directed towards the middle region of human AOC2 |
AOC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AOC2 |
AOC3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AOC3 |
AOC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AOC2 |