Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842) |
Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
Rabbit Polyclonal Anti-C1galt1c1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1galt1c1 Antibody is: synthetic peptide directed towards the N-terminal region of Rat C1galt1c1. Synthetic peptide located within the following region: SFQVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDT |
Active filters
Reactivities
- Rat
Families
- Transmembrane
Pathways
- O-Glycan biosynthesis