Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PRDM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES |
Goat Polyclonal Anti-PRDM1 / MEL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1. |
PRDM1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KVKQETVEPMDP, from the C-Terminus of the protein sequence according to NP_001189.2; NP_878911.1. |
Mouse Monoclonal anti-Blimp-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Blimp-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Blimp-1 Antibody: Peptide sequence around aa.124~128(D-T-V-P-K) derived from Human Blimp-1 |
Rabbit polyclonal PRDM1 BLIMP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of human, mouse, and rat PRDM1/BLIMP1. |
Rabbit polyclonal PRDM1 Antibody (N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PRDM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 106-134 amino acids from the N-terminal region of human PRDM1. |
Rabbit Polyclonal Anti-PRDM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the N terminal of human PRDM1. Synthetic peptide located within the following region: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN |
Active filters
Target Symbol
- PRDM1
Reactivities
- Human
Families
- Transcription Factors