Mouse Monoclonal Blimp-1 Antibody (3H2-E8)
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Porcine |
Conjugation | Unconjugated |
Mouse Monoclonal Blimp-1 Antibody (3H2-E8)
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Porcine |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PRDM1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES |
Rabbit Polyclonal Blimp-1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2. |
Rabbit Polyclonal Blimp-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1. |
Goat Polyclonal Anti-PRDM1 / MEL1 Antibody
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1. |
PRDM1 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KVKQETVEPMDP, from the C-Terminus of the protein sequence according to NP_001189.2; NP_878911.1. |
Mouse Monoclonal anti-Blimp-1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Blimp-1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Blimp-1 Antibody: Peptide sequence around aa.124~128(D-T-V-P-K) derived from Human Blimp-1 |
Rabbit polyclonal PRDM1 BLIMP1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of human, mouse, and rat PRDM1/BLIMP1. |
Rabbit polyclonal PRDM1 Antibody (N-term)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This PRDM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 106-134 amino acids from the N-terminal region of human PRDM1. |
Rabbit Polyclonal Anti-PRDM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the N terminal of human PRDM1. Synthetic peptide located within the following region: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN |