Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-KLF15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF15 antibody: synthetic peptide directed towards the N terminal of human KLF15. Synthetic peptide located within the following region: DASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGS |
Goat Polyclonal Antibody against KLF15
| Applications | FC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence VDHLLPVDENFSS-C, from the N Terminus of the protein sequence according to NP_054798.1. |
Rabbit anti-KLF15 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit Polyclonal anti-KLF15 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF15 antibody: synthetic peptide directed towards the middle region of human KLF15. Synthetic peptide located within the following region: GPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVP |
Rabbit Polyclonal Anti-KLF15 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Klf15 antibody is: synthetic peptide directed towards the N-terminal region of Klf15. Synthetic peptide located within the following region: MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPC |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- KLF15
Isotypes
- IgG
Families
- Transcription Factors