Primary Antibodies

View as table Download

EXOSC3 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC3 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EXOSC3 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EXOSC3 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EXOSC3 mouse monoclonal antibody,clone 4C9, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the middle region of human EXOSC3. Synthetic peptide located within the following region: TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EXOSC3 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOSC3. Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL

EXOSC3 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EXOSC3 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated