Primary Antibodies

View as table Download

PA2G4 (EBP1) mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PA2G4 mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PA2G4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the C terminal of human PA2G4. Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ

Rabbit polyclonal EBP1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This EBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-255 amino acids from the Central region of human EBP1.

Rabbit anti-PA2G4 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PA2G4

Rabbit Polyclonal Anti-PA2G4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the middle region of human PA2G4. Synthetic peptide located within the following region: NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVD

PA2G4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human PA2G4

PA2G4 (EBP1) mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated