USD 200.00
2 Days
PSMA6 (Proteasome 20S alpha 6) mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | FC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 200.00
2 Days
PSMA6 (Proteasome 20S alpha 6) mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | FC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to 20S Proteasome alpha3 (proteasome (prosome, macropain) subunit, alpha type, 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 137 of Proteasome 20S alpha 3 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
Applications | IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 6 (Uniprot ID#P60900) |
USD 200.00
2 Days
PSMA6 (Proteasome 20S alpha 6) mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | FC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
USD 200.00
2 Days
PSMA6 mouse monoclonal antibody,clone OTI1C4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PSMD11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PSMD11 Antibody: synthetic peptide directed towards the C terminal of human PSMD11. Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit Polyclonal Anti-PSMD11 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PSMD11 |
PSMD11 mouse monoclonal antibody, clone AT1F4, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PSMD11 mouse monoclonal antibody, clone AT1F4, Purified
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
PSMA6 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA6 |
Rabbit Polyclonal Anti-PSME3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PSME3 antibody is: synthetic peptide directed towards the N-terminal region of Human PSME3. Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ |
USD 200.00
2 Days
PSMA6 (Proteasome 20S alpha 6) mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PSMD11 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PSMD11 |
Rabbit Polyclonal Anti-PSME3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSME3 antibody: synthetic peptide directed towards the C terminal of human PSME3. Synthetic peptide located within the following region: TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |