Primary Antibodies

Jump to Filters
View as table Download
p53 (TP53) Goat Polyclonal Antibody
AB0065-200

USD 355.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.
TIP49A (RUVBL1) Rabbit Polyclonal Antibody
TA330264

USD 539.00

5 Days

Rabbit Polyclonal Anti-RUVBL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RUVBL1 antibody: synthetic peptide directed towards the N terminal of human RUVBL1. Synthetic peptide located within the following region: KIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGV
CTBP2 Rabbit Polyclonal Antibody
TA339753

USD 539.00

5 Days

Rabbit Polyclonal Anti-CTBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE
Cyclin D1 (CCND1) Rabbit Polyclonal Antibody
TA321925

USD 380.00

In Stock

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
c-Myc (MYC) Rabbit Polyclonal Antibody
TA325701

USD 380.00

4 Weeks

Rabbit Polyclonal MYC Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human MYC
p53 (TP53) Rabbit Polyclonal Antibody
TA326087

USD 380.00

In Stock

Rabbit polyclonal p53 (Ab-15) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15.
p53 (TP53) Rabbit Polyclonal Antibody
TA326166

USD 380.00

4 Weeks

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications Phospho-specific
c-Myc (MYC) Rabbit Polyclonal Antibody
TA326222

USD 380.00

In Stock

Rabbit polyclonal MYC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.
p53 (TP53) Rabbit Polyclonal Antibody
TA347308

USD 580.00

5 Days

Rabbit Polyclonal p53 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.
c-Myc (MYC) Rabbit Polyclonal Antibody
TA325703

USD 380.00

4 Weeks

Rabbit Polyclonal C-myc antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human C-myc
p53 (TP53) Rabbit Polyclonal Antibody
TA326092

USD 380.00

In Stock

Rabbit polyclonal p53 (Ab-46) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 46.
p53 (TP53) Rabbit Polyclonal Antibody
TA326192

USD 380.00

In Stock

Rabbit polyclonal p53 (Ab-378) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of serine 378 (S-T-SP-R-H).
c-Myc (MYC) Rabbit Polyclonal Antibody
RA25085-100

USD 665.00

2 Weeks

c-Myc (MYC) rabbit polyclonal antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
CTBP2 Rabbit Polyclonal Antibody
TA307965

USD 625.00

5 Days

Rabbit Polyclonal antibody to CtBP2 (C-terminal binding protein 2)

Applications IF, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 197 and 417 of CtBP2 (Uniprot ID#P56545)
p53 (TP53) Rabbit Polyclonal Antibody
TA324774

USD 580.00

5 Days

Rabbit polyclonal Phospho-p53(S20) Antibody

Applications IHC, WB
Reactivities Human (Predicted: Hamster, Pig, Monkey, Rabbit)
Conjugation Unconjugated
Immunogen This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53.
Modifications Phospho-specific