Primary Antibodies

View as table Download

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

VEGFC mouse monoclonal antibody,clone 4A1, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

VEGFC mouse monoclonal antibody,clone 4A1, HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-VEGFC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C

VEGFC mouse monoclonal antibody, clone 9E7, Purified

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3

Rabbit Polyclonal Anti-VEGFC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD