STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
STC1 mouse monoclonal antibody,clone OTI6D12, Biotinylated
Applications | WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
STC1 mouse monoclonal antibody,clone OTI6D12, HRP conjugated
Applications | WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | HRP |
STC1 mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
STC1 mouse monoclonal antibody,clone OTI1E9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
STC1 mouse monoclonal antibody,clone OTI1E9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-STC1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STC1 |
STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Stanniocalcin 1 (STC1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 192-221aa) of human Stanniocalcin-1. |
Rabbit Polyclonal Anti-STC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STC1 antibody: synthetic peptide directed towards the N terminal of human STC1. Synthetic peptide located within the following region: MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL |
STC1 mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |