Primary Antibodies

View as table Download

STC1 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-STC1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STC1

Stanniocalcin 1 (STC1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 192-221aa) of human Stanniocalcin-1.

Rabbit Polyclonal Anti-STC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STC1 antibody: synthetic peptide directed towards the N terminal of human STC1. Synthetic peptide located within the following region: MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL

STC1 mouse monoclonal antibody,clone OTI1E9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated