Primary Antibodies

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

Mouse Monoclonal CCL2/MCP1 Antibody (2D8)

Applications ELISA, FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

RANTES (CCL5) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 50-100 of Human RANTES.

Rabbit Polyclonal TNF-alpha Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta

Rabbit Polyclonal CCL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human CCL2.

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.

Goat Polyclonal Anti-TNF alpha Antibody

Applications WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant human TNF-_ produced in E. coli.

Rabbit polyclonal anti-CXCL1 (KC) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 78 of mouse KC

Rabbit Polyclonal Anti-GRO alpha

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

Rabbit Polyclonal Anti-Interleukin 1β Antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β

Rabbit Polyclonal TNFA Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TNFA