Primary Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

C2 mouse monoclonal antibody,clone OTI12G10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal antibody to Complement C2 (complement component 2)

Applications IF, WB
Reactivities Human (Predicted: Pig, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 265 and 642 of Complement C2 (Uniprot ID#P06681)

C2 mouse monoclonal antibody,clone OTI1A7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the middle region of human C2. Synthetic peptide located within the following region: INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ

C2 rabbit polyclonal antibody, Serum

Applications ID, IP
Reactivities Human
Conjugation Unconjugated
Immunogen The C2 component of human complement is a single-chain polypeptide with a molecular weight of 110,000. It is present in plasma in an average concentration of 25 μg/ml. The activated form of C2 combines with the activated C4 to form a complex with C3-convertase activity in the classical pathway of complement activation. C2 is isolated as a homogenous protein for use in the antiserum production.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

C2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Hamster, Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 147-176 amino acids from the N-terminal region of human C2

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS