SEMA3G (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 216-244 amino acids from the Central region of Human SEMA3G |
SEMA3G (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 216-244 amino acids from the Central region of Human SEMA3G |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit Polyclonal SEMA3B Antibody
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200). |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
SEMA3G mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEMA3G mouse monoclonal antibody,clone OTI8E10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEMA3G mouse monoclonal antibody,clone OTI8B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEMA3G mouse monoclonal antibody,clone OTI8E10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SEMA3G mouse monoclonal antibody,clone OTI8B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEMA3G mouse monoclonal antibody,clone OTI2C3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEMA3G mouse monoclonal antibody,clone OTI8B10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SEMA3G mouse monoclonal antibody,clone OTI8B9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-Sema3f Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
USD 509.00
2 Weeks
SEMA3G mouse monoclonal antibody,clone OTI2C3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SEMA3G mouse monoclonal antibody,clone OTI2C3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |