Primary Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) TFF1 mouse monoclonal antibody,clone OTI2C8

Applications IHC
Reactivities Human
Conjugation Unconjugated

TFF1 mouse monoclonal antibody,clone OTI7B12

Applications IHC
Reactivities Human
Conjugation Unconjugated

TFF1 mouse monoclonal antibody,clone OTI1F5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TFF1 mouse monoclonal antibody,clone OTI1F5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TFF1 mouse monoclonal antibody,clone OTI1F5

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TFF1 mouse monoclonal antibody, clone C-3D5, Aff - Purified

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-TFF1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-84 amino acids of human trefoil factor 1

TFF1 mouse monoclonal antibody,clone OTI2C8

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TFF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TFF1 antibody: synthetic peptide directed towards the middle region of human TFF1. Synthetic peptide located within the following region: PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF