Primary Antibodies

View as table Download

ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 190.00

USD 380.00

In Stock

Rabbit polyclonal anti-ACVL1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACVL1.

ACVRL1 mouse monoclonal antibody,clone OTI5C2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ACVRL1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KISNSPEKPKVIQ, from the C Terminus of the protein sequence according to NP_000011.2; NP_001070869.1.

Rabbit Polyclonal Anti-ACVRL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVRL1 antibody: synthetic peptide directed towards the N terminal of human ACVRL1. Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH