Rabbit Polyclonal Anti-TLK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLK2 |
Rabbit Polyclonal Anti-TLK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLK2 |
Rabbit Polyclonal Anti-TLK2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLK2 antibody: synthetic peptide directed towards the N terminal of human TLK2. Synthetic peptide located within the following region: VSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKN |
Rabbit Polyclonal Anti-TLK2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TLK2 antibody: synthetic peptide directed towards the N terminal of human TLK2. Synthetic peptide located within the following region: SNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYETSQGKGTPRGHKI |