Primary Antibodies

Jump to Filters
View as table Download
MYSM1 Rabbit Polyclonal Antibody
TA323310

USD 380.00

In Stock

Anti-MYSM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 808-821 amino acids of Human Myb-like, SWIRM and MPN domains 1
MYSM1 (N-term) Rabbit Polyclonal Antibody
AP52802PU-N

USD 580.00

2 Weeks

MYSM1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 118-147aa) of human MYSM1
MYSM1 Rabbit Polyclonal Antibody
TA323309

USD 380.00

In Stock

Anti-MYSM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 808-821 amino acids of Human Myb-like, SWIRM and MPN domains 1
MYSM1 Rabbit Polyclonal Antibody
TA334332

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYSM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the C-terminal region of Human MYSM1. Synthetic peptide located within the following region: CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC
MYSM1 Rabbit Polyclonal Antibody
TA334333

USD 539.00

5 Days

Rabbit Polyclonal Anti-MYSM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the N-terminal region of Human MYSM1. Synthetic peptide located within the following region: KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK