Goat Polyclonal Antibody against DPP10
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEGHNVSEKSKYHL, from the internal region of the protein sequence according to NP_065919.2; NP_001004360.1. |
Rabbit Polyclonal Anti-DPP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE |
Germany
Japan
United Kingdom
China
